PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2KG245800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 590aa    MW: 64552 Da    PI: 6.9061
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2KG245800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.51.7e-112421757
                         HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox 17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                         +++ ++ +p+ e+++ L + +gL+ + Vk+WFqNrR + kk
  Pavir.2KG245800.1.p  2 AVYDQCTHPDPEAMQALGAMIGLEPKHVKFWFQNRRSQVKK 42
                         57999********************************9987 PP

2START114.81.3e-3618537732205
                          EEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S..EEEEE..EEECTT....EEEEEEEEXXTTXX-SSX. CS
                START  32 evlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla..kaetl..evissg....galqlmvaelqalsplvp. 106
                          e++ kf+++ +      + +ea r+ ++v + +a+lv++++d++ +W+et++   a+++  +v+s+g    g +qlm+ae+ + sp vp 
  Pavir.2KG245800.1.p 185 EYRAKFSQALFglrpegFAVEATRDAAIVWGSAAELVSIFMDTA-RWSETFPgvVASVVagDVVSTGsftdGQIQLMNAEMWVQSPCVPn 273
                          6777886655588888889*************************.********96666533799999*********************** PP

                          EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHH CS
                START 107 RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglae 191
                          R + ++Ry++   + +w+++dvSvd    ++       + ++ ++llpSg+lie++sng++kvtw+ h+++++ + +  +r+l  +g+a+
  Pavir.2KG245800.1.p 274 RTVNILRYSKLVAERKWAVMDVSVDGIFGQEVllaylPARYMGCRLLPSGCLIEDMSNGYCKVTWIVHAEYDETTMPTTFRPLFLNGQAM 363
                          ************************9765555555888899************************************************** PP

                          HHHHHHHHTXXXXX CS
                START 192 gaktwvatlqrqce 205
                           a++w+a lq q+e
  Pavir.2KG245800.1.p 364 CARRWLASLQMQRE 377
                          **********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.629143IPR001356Homeobox domain
CDDcd000865.36E-8243No hitNo description
PfamPF000463.8E-9242IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-10350IPR009057Homeodomain-like
SuperFamilySSF466891.71E-9350IPR009057Homeodomain-like
PROSITE profilePS5084826.221133381IPR002913START domain
CDDcd088751.37E-70140377No hitNo description
SMARTSM002346.0E-14142378IPR002913START domain
PfamPF018521.1E-29186377IPR002913START domain
SuperFamilySSF559611.2E-17200361No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MAVYDQCTHP DPEAMQALGA MIGLEPKHVK FWFQNRRSQV KKKDQQEQNQ QMQQVNASLK  60
AENWSLRKAI LTQTCVTCCG KTLPFNPLLE KQHLLTKNAE LKDKFLRVSA IQSKIIRDSA  120
FTQPAPWISS RSSEVDREAL LHYTKASMEQ FLVLATKGEP SFQKTMGELM WLPAADGGEV  180
LNFVEYRAKF SQALFGLRPE GFAVEATRDA AIVWGSAAEL VSIFMDTARW SETFPGVVAS  240
VVAGDVVSTG SFTDGQIQLM NAEMWVQSPC VPNRTVNILR YSKLVAERKW AVMDVSVDGI  300
FGQEVLLAYL PARYMGCRLL PSGCLIEDMS NGYCKVTWIV HAEYDETTMP TTFRPLFLNG  360
QAMCARRWLA SLQMQREYAA ALYSSLHPGN NNAAKAVGML KLAQQMMASF YAAVSGPIAP  420
TQATTSINDW FGSVGTGIER FDAAVRMVTW EKPGSSMAGE PASCFLSATT TLWLPCTPPE  480
HVFNYLRNKK RRGEWDFVLA NGAAVKELGS VSMGCHLAGN VISILSSMTD GTNDRVLILQ  540
EVRTEASGSL VVYTPIGEGA MDAAMGGDSG GASNFPTPSG FAILPDGRG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008651753.11e-176PREDICTED: uncharacterized protein LOC100383907 isoform X1
RefseqXP_008651754.11e-176PREDICTED: uncharacterized protein LOC100383907 isoform X1
TrEMBLK4A0K40.0K4A0K4_SETIT; Uncharacterized protein
STRINGSi032393m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83241742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.11e-95homeodomain GLABROUS 1